PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G42380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 256aa    MW: 28291.5 Da    PI: 5.1884
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G42380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.82.8e-4291422128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......kvka...eekewyfFskrdkkyatgkrknratksgyWkat 86 
                      +pGfrF Pt+eel+++yL++k++g + ++e+vi+ +d+y+v+P +L +         +   e + w++F++r++++a+g r++r+t sgyWka 
  OGLUM01G42380.1   9 APGFRFYPTEEELICFYLRNKLDGLRDDIERVIPVFDVYSVDPLQLSEihhemlG--GggeEGEPWFYFCPRQEREARGGRPSRTTPSGYWKAA 100
                      59***************************99***************854555431..14335669***************************** PP

              NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      g+   v+s++++ +g+kkt+vfy+grap+g+kt W m+eyr+
  OGLUM01G42380.1 101 GTPGVVYSADRRPIGMKKTMVFYRGRAPSGTKTAWKMNEYRA 142
                      ****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100544.4438181IPR003441NAC domain
SuperFamilySSF1019414.71E-469180IPR003441NAC domain
PfamPF023659.3E-2410141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MADGGGRRAP GFRFYPTEEE LICFYLRNKL DGLRDDIERV IPVFDVYSVD PLQLSEIHHE  60
MLGGGGEEGE PWFYFCPRQE REARGGRPSR TTPSGYWKAA GTPGVVYSAD RRPIGMKKTM  120
VFYRGRAPSG TKTAWKMNEY RAFHYPDASS ASASSAGAAA PPNHLPPQLR SEFSLCRLYT  180
RSGGIRQFDR RPLAGGGDEN PGPSMAAAAA SPEENDGSGC SMQQLELMDQ GGAVDPDWDQ  240
WDDLATLTAL LYWPRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-281014422147NAC domain-containing protein 19
3swm_B9e-281014422147NAC domain-containing protein 19
3swm_C9e-281014422147NAC domain-containing protein 19
3swm_D9e-281014422147NAC domain-containing protein 19
3swp_A9e-281014422147NAC domain-containing protein 19
3swp_B9e-281014422147NAC domain-containing protein 19
3swp_C9e-281014422147NAC domain-containing protein 19
3swp_D9e-281014422147NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0712740.0AK071274.1 Oryza sativa Japonica Group cDNA clone:J023087C18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632691.10.0PREDICTED: NAC domain-containing protein 90 isoform X2
SwissprotQ9FMR31e-64NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D9YHT30.0A0A0D9YHT3_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g64310.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA004848-PA0.0(Oryza sativa Indica Group)
STRINGORGLA01G0320200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-61NAC domain containing protein 90